PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv3_063410_ixst.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 690aa    MW: 75235.3 Da    PI: 5.8655
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv3_063410_ixst.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.43.6e-14223283363
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         ++kr  r+++NRe+A+ sRqRKk+++eeLe+k  ++ +  ++L  +++ +  e a+l++++
  Bv3_063410_ixst.t1 223 DDKRKARLMRNRESAQLSRQRKKQYVEELEDKLRSMHSTITDLNGKISYMMAENATLRQQL 283
                         69**********************************************9999999999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.7E-17221285IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.519223286IPR004827Basic-leucine zipper domain
PfamPF001701.4E-11224283IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.38E-12225283No hitNo description
Gene3DG3DSA:1.20.5.1701.6E-16225283No hitNo description
CDDcd147045.89E-21226277No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MEDPLTYDSN PNSLPIPPLD EAHLLSADFF SVAGENNDVV VDDFSFGVDF DFSFDDLTFA  60
DDLLLEPPLE PPENPTSDDF SVVSEIRNSG DSEVDRNPNP RVYECSSPEE ANQGPISSEE  120
SNFGAKLSCP SSDSGNSSDR DVSSSSFVRN SEDLNLSQVK VEKTIVRKSS SNNDNKCVMS  180
KRKKEHENEL VEGESRVNKF RRSSLMEENG SVIVDDGGSN DGDDKRKARL MRNRESAQLS  240
RQRKKQYVEE LEDKLRSMHS TITDLNGKIS YMMAENATLR QQLTGVGACG AAPPPPGMYP  300
MGPMPYPWMA YPPYMVKPQG SHVPLVPIPR WKPQLPAQAP KASKRSDSKK GERKTKKVAS  360
VSFLGLLFFM LLFGGLVPLV NVKYGGVGNG FDGMQRGSVF MVDKHVGKFS SHGRILQQSN  420
SLDGIGSTVN SSEPLVASLY VPRNDKLVKI DGNLIIHSVL ASEKAMASQT AEGVKPSEET  480
GLAIHGSYPP YPIPGPGSND WRHPHLDRNQ HGRQRALTSG SSDEFKPSGS DGKLQEWFRE  540
GLAGPMLSSG MCTEVFQFDV SPTPGAIVPA ASMANISSEH RQNSTSPNKP RNRRILHEPA  600
IPLAGHIVNA SEEHVPHEQN GGLQGNKSSS SMVVSVLVDP REIGDGDGEG VIRSKTVSRI  660
FVVVLIDSVK YVTYSCMLPF MGSGNHLVTT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1580593RQNSTSPNKPRNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010673077.10.0PREDICTED: uncharacterized protein LOC104889531
SwissprotO222081e-146BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A0J8FH450.0A0A0J8FH45_BETVU; Uncharacterized protein
STRINGVIT_08s0040g00870.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-126bZIP family protein